SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003651761.1.78621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003651761.1.78621
Domain Number 1 Region: 71-231
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.04e-37
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 273-473
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-29
Family Nuclease 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003651761.1.78621
Sequence length 521
Comment phospholipase D family protein [Acinetobacter calcoaceticus]; AA=GCF_000162035.1; RF=na; TAX=575585; STAX=471; NAME=Acinetobacter calcoaceticus RUH2202; strain=RUH2202; AL=Scaffold; RT=Major
Sequence
MINQLYQQYSTIASSAWGFTDLPSYTDTYDPNENDTVTNSFNWLNDEQATEKTEQGLTAF
VALDDAFISIASRMYLIRNAKEKIDLQYYIWTNDFVGNLMLHELLTAADRGVKIRLLIDD
QNGVKLDGVLRSLLHHPNFEIRLFNPYKFRYLRILDYIFRFKKVNHRMHNKLIIADGAIA
VTGGRNISSEYFDASSKFQFTDLDILFYGHTVQHAQTVFNDFWQSELSQDATELIGTCAV
HHLQSLRQHYHDLIHENEKHNQTEDKLYDAQSYLKELLEHYPIQWAKAYFVADSPKKILG
TASKQDMLYGQVLAIMGEPKQHIELASAYFVPTQQGAYYLKQLKVQGVKVRVLTNSFAAN
DVAIVHAFYSQYRVEMLKSGVELFEFKPFLERRRRTWYEVVTGSVIPAKGKNKSSLHAKF
FDVDGKVFIGSFNFDPRSTYLNTEVGLVIESSQLQAQVSVMLDQHLPQVAYQLKLNNEGK
IIWLDYQSNGNVVEYENDPDTSLFQRTMIKAVSYLPVEWMM
Download sequence
Identical sequences D0RXZ7
WP_003651761.1.78621 HMPREF0012_01049T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]