SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003851235.1.56495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003851235.1.56495
Domain Number 1 Region: 18-171
Classification Level Classification E-value
Superfamily Nudix 9.88e-29
Family MutT-like 0.017
Further Details:      
 
Domain Number 2 Region: 175-324
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.33e-19
Family Cofactor-dependent phosphoglycerate mutase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003851235.1.56495
Sequence length 336
Comment NUDIX hydrolase [Corynebacterium diphtheriae]; AA=GCF_002202895.1; RF=na; TAX=1806053; STAX=1717; NAME=Corynebacterium diphtheriae bv. mitis; strain=5152; AL=Contig; RT=Major
Sequence
MTSSNKLHEVDKDQQSAFDITGRYQTISAHPTKEFSKPTLAAGAVLWRHSSTITENPAVE
FAVIHRPHYDDWSLAKGKVDPGESLPVTAEREIREETGHHVHLGKLLGKVSYPVGERTKV
VYYWIAQVHDEAFEENNEVDELRWLPYTEARELLSYDVDRLVLDKAYKRLALPTTTRVIL
VRHAKAHQRHNWAGNDSIRPLEKKGQRQADLLGPMLAAYGPTSIHSATPARCQQTAAPLS
ELTGLEVVVDDRFDDEAWLSRMTVAQKACEELIATPGTHVVVSQGLFIPDAIAWLSAQGR
LPLETIEAKKASAWVLSFHEGELTGADYLVSPLGVK
Download sequence
Identical sequences A0A0F5DBH7 Q6NHK8
257309.DIP1129 gi|376287636|ref|YP_005160202.1| gi|38233719|ref|NP_939486.1| APC82660 gi|376284633|ref|YP_005157843.1| gi|375292970|ref|YP_005127509.1| gi|376242720|ref|YP_005133572.1| WP_003851235.1.100106 WP_003851235.1.11186 WP_003851235.1.12056 WP_003851235.1.12321 WP_003851235.1.15382 WP_003851235.1.16169 WP_003851235.1.16198 WP_003851235.1.16616 WP_003851235.1.16923 WP_003851235.1.17258 WP_003851235.1.1865 WP_003851235.1.18730 WP_003851235.1.19402 WP_003851235.1.21235 WP_003851235.1.21794 WP_003851235.1.22617 WP_003851235.1.2359 WP_003851235.1.24021 WP_003851235.1.24410 WP_003851235.1.24452 WP_003851235.1.24530 WP_003851235.1.25161 WP_003851235.1.26788 WP_003851235.1.29044 WP_003851235.1.31012 WP_003851235.1.31738 WP_003851235.1.33126 WP_003851235.1.33228 WP_003851235.1.33864 WP_003851235.1.34071 WP_003851235.1.35664 WP_003851235.1.36295 WP_003851235.1.36771 WP_003851235.1.38550 WP_003851235.1.39547 WP_003851235.1.41054 WP_003851235.1.42841 WP_003851235.1.43515 WP_003851235.1.43592 WP_003851235.1.4375 WP_003851235.1.44089 WP_003851235.1.4494 WP_003851235.1.45526 WP_003851235.1.47154 WP_003851235.1.51796 WP_003851235.1.52928 WP_003851235.1.53607 WP_003851235.1.5502 WP_003851235.1.55162 WP_003851235.1.56495 WP_003851235.1.56555 WP_003851235.1.56727 WP_003851235.1.56858 WP_003851235.1.57683 WP_003851235.1.57961 WP_003851235.1.580 WP_003851235.1.58917 WP_003851235.1.60254 WP_003851235.1.63172 WP_003851235.1.64345 WP_003851235.1.65864 WP_003851235.1.67038 WP_003851235.1.67410 WP_003851235.1.68611 WP_003851235.1.69403 WP_003851235.1.70128 WP_003851235.1.70439 WP_003851235.1.70634 WP_003851235.1.71515 WP_003851235.1.73245 WP_003851235.1.73495 WP_003851235.1.73977 WP_003851235.1.74211 WP_003851235.1.74589 WP_003851235.1.77064 WP_003851235.1.80770 WP_003851235.1.81 WP_003851235.1.816 WP_003851235.1.82314 WP_003851235.1.82318 WP_003851235.1.8291 WP_003851235.1.83106 WP_003851235.1.83857 WP_003851235.1.85853 WP_003851235.1.85905 WP_003851235.1.86054 WP_003851235.1.86272 WP_003851235.1.91366 WP_003851235.1.92257 WP_003851235.1.93248 WP_003851235.1.93774 WP_003851235.1.95829 WP_003851235.1.95894 WP_003851235.1.96122 WP_003851235.1.96168 WP_003851235.1.97137 WP_003851235.1.97188 WP_003851235.1.98240 WP_003851235.1.98565 WP_003851235.1.99854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]