SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003874785.1.99050 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003874785.1.99050
Domain Number 1 Region: 13-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.58e-52
Family Methylesterase CheB, C-terminal domain 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003874785.1.99050
Sequence length 339
Comment MULTISPECIES: chemotaxis protein CheB [Mycobacterium avium complex (MAC)]; AA=GCF_001936215.1; RF=na; TAX=439334; STAX=1764; NAME=Mycobacterium avium subsp. hominissuis; strain=H87; AL=Complete Genome; RT=Major
Sequence
MVIAAADGDLQSDLRGAVAIGASAGGVEALSNLAAGLSPDVPFAYLMVLHVPAGAPSILA
RIIDRSGPLPASAAQDGAPLQPGHIYVGVPDRHLLVDGAHVLLSQGPTENGHRPAINALF
RSVALTFGPRAIGVLLSGVLDDGVLGMAAIRSRGGVTVCQSPDDALFPAMPANALDAGVV
DRQAAAADIGVVLKELAHREIEDPDMQRDPGMELENRIAMMSRFATDFDTEKLGPPSGYT
CPDCNGSLVSLSEGNYRCRVGHAWTAEALLSARDNELEGALWVAVRSLQEKARLARDMAG
KAGAGLLSRRYTQIAEESERALHVLSHRLAGAAAEGETR
Download sequence
Identical sequences A0A202FRI2 A0A2A2ZUP9 A0A2A3L476 Q73UY1 T2GXY8 V7NCK7
gi|41409333|ref|NP_962169.1| 262316.MAP3235c WP_003874785.1.10000 WP_003874785.1.101064 WP_003874785.1.101159 WP_003874785.1.12505 WP_003874785.1.12954 WP_003874785.1.1369 WP_003874785.1.14691 WP_003874785.1.14707 WP_003874785.1.14816 WP_003874785.1.15663 WP_003874785.1.1614 WP_003874785.1.16945 WP_003874785.1.17266 WP_003874785.1.17321 WP_003874785.1.17624 WP_003874785.1.17884 WP_003874785.1.17915 WP_003874785.1.18785 WP_003874785.1.1994 WP_003874785.1.20882 WP_003874785.1.22278 WP_003874785.1.22600 WP_003874785.1.22949 WP_003874785.1.23768 WP_003874785.1.26008 WP_003874785.1.27804 WP_003874785.1.28864 WP_003874785.1.29527 WP_003874785.1.31474 WP_003874785.1.32203 WP_003874785.1.3468 WP_003874785.1.35510 WP_003874785.1.35606 WP_003874785.1.36073 WP_003874785.1.37369 WP_003874785.1.37642 WP_003874785.1.38978 WP_003874785.1.3962 WP_003874785.1.40244 WP_003874785.1.40837 WP_003874785.1.42052 WP_003874785.1.44666 WP_003874785.1.45459 WP_003874785.1.45501 WP_003874785.1.47364 WP_003874785.1.4754 WP_003874785.1.49379 WP_003874785.1.50439 WP_003874785.1.50890 WP_003874785.1.53280 WP_003874785.1.53771 WP_003874785.1.54538 WP_003874785.1.55522 WP_003874785.1.55945 WP_003874785.1.56146 WP_003874785.1.56366 WP_003874785.1.56924 WP_003874785.1.58557 WP_003874785.1.59206 WP_003874785.1.59922 WP_003874785.1.60164 WP_003874785.1.61195 WP_003874785.1.62105 WP_003874785.1.62113 WP_003874785.1.62963 WP_003874785.1.63545 WP_003874785.1.64277 WP_003874785.1.646 WP_003874785.1.64827 WP_003874785.1.64833 WP_003874785.1.65674 WP_003874785.1.65884 WP_003874785.1.66027 WP_003874785.1.66097 WP_003874785.1.66499 WP_003874785.1.66905 WP_003874785.1.67083 WP_003874785.1.6888 WP_003874785.1.69393 WP_003874785.1.70933 WP_003874785.1.71252 WP_003874785.1.74562 WP_003874785.1.74957 WP_003874785.1.75695 WP_003874785.1.75798 WP_003874785.1.76287 WP_003874785.1.78145 WP_003874785.1.78536 WP_003874785.1.7926 WP_003874785.1.80920 WP_003874785.1.81101 WP_003874785.1.81559 WP_003874785.1.8174 WP_003874785.1.82097 WP_003874785.1.82175 WP_003874785.1.82859 WP_003874785.1.83216 WP_003874785.1.83808 WP_003874785.1.84212 WP_003874785.1.85628 WP_003874785.1.86358 WP_003874785.1.87305 WP_003874785.1.8774 WP_003874785.1.88396 WP_003874785.1.88567 WP_003874785.1.89157 WP_003874785.1.92407 WP_003874785.1.9350 WP_003874785.1.94747 WP_003874785.1.95123 WP_003874785.1.95627 WP_003874785.1.96060 WP_003874785.1.9734 WP_003874785.1.98724 WP_003874785.1.98852 WP_003874785.1.98895 WP_003874785.1.99050 gi|499074947|ref|YP_007970425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]