SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003985161.1.64888 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003985161.1.64888
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000262
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003985161.1.64888
Sequence length 144
Comment MULTISPECIES: cell wall assembly protein [Streptomyces]; AA=GCF_001279105.1; RF=na; TAX=132474; STAX=1927; NAME=Streptomyces rimosus subsp. rimosus; strain=NRRL WC-3873; AL=Contig; RT=Major
Sequence
MWKEAARAAWPDAEFAPPVAPGDLTDAEHRLGCGLPAELTGLLRETDGVVGPYGIDAVWP
LERIVEQNLRFRSDHSLAELYMPFDALLFFGDNGGGDQFAFVRTPPRPDVFVWEHEDDSR
RWAARDLRDYLRRCLAADGEDWYR
Download sequence
Identical sequences A0A0L8PYY2 A0A0X3RF72 L8EHY2
WP_003985161.1.100537 WP_003985161.1.10659 WP_003985161.1.11843 WP_003985161.1.16484 WP_003985161.1.16806 WP_003985161.1.16854 WP_003985161.1.19068 WP_003985161.1.23387 WP_003985161.1.27584 WP_003985161.1.27877 WP_003985161.1.29142 WP_003985161.1.29667 WP_003985161.1.40819 WP_003985161.1.41790 WP_003985161.1.44064 WP_003985161.1.46139 WP_003985161.1.47700 WP_003985161.1.55007 WP_003985161.1.64888 WP_003985161.1.65676 WP_003985161.1.69365 WP_003985161.1.72292 WP_003985161.1.75076 WP_003985161.1.7965 WP_003985161.1.86519 WP_003985161.1.86803 WP_003985161.1.87188 WP_003985161.1.91872 WP_003985161.1.92884 WP_003985161.1.9496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]