SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004059783.1.35700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004059783.1.35700
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.19e-55
Family NADH oxidase/flavin reductase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004059783.1.35700
Sequence length 223
Comment NAD(P)H nitroreductase [Haloferax mediterranei]; AA=GCF_000306765.2; RF=representative genome; TAX=523841; STAX=2252; NAME=Haloferax mediterranei ATCC 33500; strain=CGMCC 1.2087; AL=Complete Genome; RT=Major
Sequence
MDFEEVVATRRSIHEYADEPLDDETLETIFENAIQAPSSYNLQPWEFVVLREDETKQALR
EAAYDQEHVTGAAASVIILGNKDPEAHAQTVADDMLEKGYLPNEDARDGVLESIAGMADL
PEQERRVWTVRSTSLVAMSLMNAAWDEGVGTCPIGGFDPDAVLEAFDIDGEQYEPVMLLT
MGIPAEDAGELQAEKKYRRPVDEVVHYEAFAPEQTADPAPADD
Download sequence
Identical sequences I3R748
gi|389847806|ref|YP_006350045.1| WP_004059783.1.26851 WP_004059783.1.35700 WP_004059783.1.77170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]