SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004059783.1.77170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004059783.1.77170
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.19e-55
Family NADH oxidase/flavin reductase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004059783.1.77170
Sequence length 223
Comment NAD(P)H nitroreductase [Haloferax mediterranei]; AA=GCF_000337295.1; RF=na; TAX=523841; STAX=2252; NAME=Haloferax mediterranei ATCC 33500; strain=ATCC 33500; AL=Contig; RT=Major
Sequence
MDFEEVVATRRSIHEYADEPLDDETLETIFENAIQAPSSYNLQPWEFVVLREDETKQALR
EAAYDQEHVTGAAASVIILGNKDPEAHAQTVADDMLEKGYLPNEDARDGVLESIAGMADL
PEQERRVWTVRSTSLVAMSLMNAAWDEGVGTCPIGGFDPDAVLEAFDIDGEQYEPVMLLT
MGIPAEDAGELQAEKKYRRPVDEVVHYEAFAPEQTADPAPADD
Download sequence
Identical sequences I3R748
WP_004059783.1.26851 WP_004059783.1.35700 WP_004059783.1.77170 gi|389847806|ref|YP_006350045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]