SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004216472.1.81346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004216472.1.81346
Domain Number 1 Region: 136-408
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-78
Family Subtilases 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004216472.1.81346
Sequence length 683
Comment peptidase S8 [Natrialba magadii]; AA=GCF_000025625.1; RF=representative genome; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=ATCC 43099; AL=Complete Genome; RT=Major
Sequence
MQPERRDTRSRRSILRGAGAVGGLIGATGLSSATPGRSPGPKQTELLVGINDEYARSSAN
GTERTAREAVPADATVVHSNEQLEYVAIEVPAELPSEAVEHVRDVLDSNDAIEYVEENAT
LQSLYTPNDPYYDSQHAPQQVNCEDAWAETLGDEDVTIAVVDQGVEYEHENLSGNVDDRI
GEVFVGRGSDPGPLSRGDTHGTLVAGIAAGETGNGTGQAGISNCSLLAARALDEQGQGAL
SDIADAIQWAADEGVDVINLSLGSSSGLWTLENACEYATERGCLVVAAAGNSGGSVMYPA
AYDDVLAVSALTSRDRLASFSNRGPEIDLAAPGQNLLSTTLNDGYDRISGTSAAAPVVAG
VAGLVRSVYPGLSSSALREHLRETAVDVGLRSAAQGAGRVDAGNAVTTVPEGYDGPDERD
GDTDEDEEDDEDDEETDTDGHLLSFVTEPEASFADYEFTATGPVEFTTAPGQTPSGGTIE
GGTYAAEDYIEEDDETWHAGGVTGGGQGDAFSVEGAITSIEVGQPDVMWVELDGERLSPE
EVIEETTGDDTDETDGGEEDESDETDETDEPQCGDETNTARVEGDLDGSGWWPDTARWQY
TPQTENPCELTLTVDGPSGADVELYMTRDGRRPTQWDADESATATGDTQSLTTALESDDT
VRILITATGGSGTYELEIVEQGY
Download sequence
Identical sequences D3SZG5
WP_004216472.1.6702 WP_004216472.1.81346 gi|289580395|ref|YP_003478861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]