SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004301755.1.58410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004301755.1.58410
Domain Number 1 Region: 126-540
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.05e-77
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00013
Further Details:      
 
Domain Number 2 Region: 8-119
Classification Level Classification E-value
Superfamily Cytochrome c 1.69e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004301755.1.58410
Sequence length 547
Comment MULTISPECIES: cytochrome CBB3 [Thauera]; AA=GCF_000021765.1; RF=na; TAX=85643; STAX=85643; NAME=Thauera sp. MZ1T; strain=MZ1T; AL=Complete Genome; RT=Major
Sequence
MKIRASTLTGLFALAGALVVLPAAASPDKAVARAASGAAASPAAIDVPALYAQHCAACHA
PNRLGAMGPALLPDNLGRLRKSEAAKVIAEGRPATQMAGFAAQLGKDEIAALTEWIYTPV
VPEPRWTDEDIRASRVVHVDTATLSDKPVFDADPLNLFLVVEAGDHHVSVLDGDRLEPIH
RFQSRFALHGGPKFAANGRYVFFASRDGWITKFDLWNLKVVAEVRAGINTRNVAASPDGT
HVAVANYLPNTLVLLDGELNLVKTIPAMDRDGKKSSRVSAVYDATPRQSFIAALKDVGEV
WEISYTKAVEDIPVSYIHDYTQREGSFIPGYLNPRRTILAEVLDDFFFTQDYSELMGASR
EGVGQVVNLDVRKKIANLPLDGMPHLGSGITWEWQDPAAGPGARPRTVMASTNLKAGEVT
VIDMKTWEVVKRIPTRGPGFFLRSHSSSRYAFVDSMMSAEAKHILQVIDKQTLEVVREIT
GEPGKTLAHVEFTRDGRHALASLWEDDGAVIVYDARTLEEVKRLPMRKPVGKYNVWNKIT
REEGTSH
Download sequence
Identical sequences C4K9Y4 N6Z5A9
gi|237653273|ref|YP_002889587.1| 85643.Tmz1t_2608 WP_004301755.1.58410 WP_004301755.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]