SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004350666.1.25444 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004350666.1.25444
Domain Number 1 Region: 106-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.02e-34
Family Glutathione peroxidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004350666.1.25444
Sequence length 278
Comment MULTISPECIES: hypothetical protein [Proteobacteria]; AA=GCF_001994495.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC10023; AL=Contig; RT=Major
Sequence
MISVGPFSVQVVAVFLAVLLAWAVARMVAKRLPDSPYKAAGGMLLDAAFVGFVAARLGYI
AQWWEEYAQSPMSMISIGDQGFSWWVGVLAALALIWWRTRAVRALRRPVLAGVAVGLAAW
FATGGVLALLQRSAPPLPALTLATLDEQPVVLNSYAGRPVVLNLWASWCPPCRREMPVFE
QAQAQYPDIAFVMVNQGESAQQARAFLESERLHLKDVLLDPASQTMQAVASRGLPTTLFF
DEQGRLVDTHLGELTMASLKHTVSRRFAPAQQIKTDKE
Download sequence
Identical sequences A0A1G7UGG4 A0A1V2XTB8 A0A2E9RYX2 Q1LKQ4 Q8GQA1
266264.Rmet_2395 WP_004350666.1.100899 WP_004350666.1.11058 WP_004350666.1.11178 WP_004350666.1.1187 WP_004350666.1.12400 WP_004350666.1.12480 WP_004350666.1.12497 WP_004350666.1.13092 WP_004350666.1.14096 WP_004350666.1.15789 WP_004350666.1.19260 WP_004350666.1.22782 WP_004350666.1.23231 WP_004350666.1.24442 WP_004350666.1.25444 WP_004350666.1.25839 WP_004350666.1.29003 WP_004350666.1.30810 WP_004350666.1.31271 WP_004350666.1.34731 WP_004350666.1.35599 WP_004350666.1.37542 WP_004350666.1.38510 WP_004350666.1.40482 WP_004350666.1.42634 WP_004350666.1.43022 WP_004350666.1.43317 WP_004350666.1.445 WP_004350666.1.45298 WP_004350666.1.47314 WP_004350666.1.48990 WP_004350666.1.52578 WP_004350666.1.54239 WP_004350666.1.57841 WP_004350666.1.57966 WP_004350666.1.58417 WP_004350666.1.5850 WP_004350666.1.60396 WP_004350666.1.61294 WP_004350666.1.62035 WP_004350666.1.63423 WP_004350666.1.63697 WP_004350666.1.63989 WP_004350666.1.64825 WP_004350666.1.65247 WP_004350666.1.66286 WP_004350666.1.67948 WP_004350666.1.68800 WP_004350666.1.7038 WP_004350666.1.71570 WP_004350666.1.71738 WP_004350666.1.72772 WP_004350666.1.7448 WP_004350666.1.783 WP_004350666.1.78542 WP_004350666.1.79921 WP_004350666.1.81368 WP_004350666.1.8203 WP_004350666.1.82703 WP_004350666.1.83617 WP_004350666.1.85815 WP_004350666.1.86925 WP_004350666.1.87716 WP_004350666.1.89494 WP_004350666.1.89848 WP_004350666.1.89939 WP_004350666.1.9034 WP_004350666.1.91527 WP_004350666.1.92321 WP_004350666.1.93250 WP_004350666.1.94230 WP_004350666.1.94896 WP_004350666.1.96852 WP_004350666.1.96967 WP_004350666.1.9698 WP_004350666.1.98111 WP_004350666.1.98814 WP_004350666.1.98819 WP_004350666.1.99341 gi|94311331|ref|YP_584541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]