SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004398754.1.6139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004398754.1.6139
Domain Number 1 Region: 162-269
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.37e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004398754.1.6139
Sequence length 278
Comment MULTISPECIES: rsbT co-antagonist protein rsbRD [Bacillus]; AA=GCF_001660525.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=delta6; AL=Complete Genome; RT=Major
Sequence
MIALDQHLTEHKKDITQQWLEVCTSNGSWLYSAKDQQKLEQKLKDQHELLVTIVAKSLRK
EDVEDELNRWSLQCARDRAVHEVTVTQSVGQFNTFRHIMFEWIHKFSEASSQDISIQEFY
EWSRILNQNIDEIIEVFTEEYHQVTMIQLNAQKEMINELSAPIMPITDGIGILPLVGEID
THRARTILESVLEQCSALKLSYLFLDISGVPIVDTMVAYQIFKVIDSTKLLGIETIISGI
RPEIAQTVVKLGLDFSNVKTEQSLAKALANKGFKIKEC
Download sequence
Identical sequences A0A162S7L3 A0A1B2BDJ0 L8AN36 P54504
224308.BSU24760 gi|255767554|ref|NP_390356.2| gi|470162683|ref|YP_007534458.1| gi|402776738|ref|YP_006630682.1| NP_390356.2.22788 WP_004398754.1.11257 WP_004398754.1.1140 WP_004398754.1.12759 WP_004398754.1.15902 WP_004398754.1.16291 WP_004398754.1.27660 WP_004398754.1.2914 WP_004398754.1.32219 WP_004398754.1.32420 WP_004398754.1.33846 WP_004398754.1.36189 WP_004398754.1.39605 WP_004398754.1.40859 WP_004398754.1.44184 WP_004398754.1.45019 WP_004398754.1.47157 WP_004398754.1.56274 WP_004398754.1.56411 WP_004398754.1.57201 WP_004398754.1.5726 WP_004398754.1.57513 WP_004398754.1.6139 WP_004398754.1.6517 WP_004398754.1.65223 WP_004398754.1.72999 WP_004398754.1.76977 WP_004398754.1.78686 WP_004398754.1.81116 WP_004398754.1.81747 WP_004398754.1.82722 WP_004398754.1.88042 WP_004398754.1.91723 WP_004398754.1.93420 WP_004398754.1.94199 WP_004398754.1.96043 WP_004398754.1.979 gi|560129428|ref|YP_008830569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]