SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004401025.1.100974 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004401025.1.100974
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000626
Family Thioltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004401025.1.100974
Sequence length 75
Comment NrdH-redoxin [Vibrio nigripulchritudo]; AA=GCF_001050615.1; RF=na; TAX=1238431; STAX=28173; NAME=Vibrio nigripulchritudo BLFn1; strain=BLFn1; AL=Contig; RT=Major
Sequence
MKRVVLYIKDKCPHCKSAQQYLDSKGIKYRLCNAKMQRGRKELDAIGARSVPVLKIGDQV
MIGWNLKNFEKMYKS
Download sequence
Identical sequences U4DZH8 U4K515
gi|549689083|ref|YP_008620815.1| WP_004401025.1.100974 WP_004401025.1.101053 WP_004401025.1.17125 WP_004401025.1.26019 WP_004401025.1.41471 WP_004401025.1.5221 WP_004401025.1.69985 WP_004401025.1.70175 WP_004401025.1.77049 WP_004401025.1.79392 WP_004401025.1.83433 WP_004401025.1.83782 WP_004401025.1.85604 WP_004401025.1.98144 WP_004401025.1.98804 WP_004401025.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]