SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004463379.1.31213 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004463379.1.31213
Domain Number 1 Region: 32-308
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.24e-53
Family beta-glycanases 0.0000108
Further Details:      
 
Domain Number 2 Region: 344-468
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-28
Family APC10-like 0.073
Further Details:      
 
Domain Number 3 Region: 482-551
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.1e-17
Family Type I dockerin domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004463379.1.31213
Sequence length 558
Comment coagulation factor 5/8 type domain protein [Ruminiclostridium thermocellum]; AA=GCF_000015865.1; RF=representative genome; TAX=203119; STAX=1515; NAME=Ruminiclostridium thermocellum ATCC 27405; strain=ATCC 27405; AL=Complete Genome; RT=Major
Sequence
MKKRVCILLAVVILMTVSLPFVTLGADDIYPGLRVQGRFLYDKYGEKIILYGVNEMSIWG
DIDGDVALPEIRKTGANAVRLVWSVSGPARKLDILLYNCRINNMIPIIELHDATGEWQKL
SMLVDYWTRPDVLEVLKKHQEYLIINIGNEVGAQVSESEFKTGYEAAVKRMREAGIHVPL
MIDGSDWGKNIDILQATGPYLINADPDKNLLFSVHMWWPYMWGYNEQKVIDEIKESVEMG
LPLVVGEFGHQWEEHEMGKIPYKTIMEQCYKNEIGYLAWSWGPGNQPQTFLDMTTDGTFD
TLRGWGLEVCVTDPYSIMNIAVRPASMLEEPTTEPPVINIPAGSIAQNKPVYASSTEPGL
GNTPEKAVDGNIATRWSSDYSDNQYIYVDLLDEYEIERVYIEWEAAYARQYKIQVSNDAV
TWTDVYTEYNGDGDIDDIYLEARGRYVRIYCMQRATQYGNSIFELGVYPKGGIAEPTPPG
VEILVGDINRDGKINSTDLGMLNRHILKLVILDDNLKLAAADIDGNGNINSTDYSWLKKY
ILKVISEFPGGDTRIVTP
Download sequence
Identical sequences A3DDM7
WP_004463379.1.16390 WP_004463379.1.31213 WP_004463379.1.60145 203119.Cthe_0821 gi|125973339|ref|YP_001037249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]