SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004720660.1.53393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004720660.1.53393
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily IpsF-like 1.24e-64
Family IpsF-like 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004720660.1.53393
Sequence length 163
Comment MULTISPECIES: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Acinetobacter]; AA=GCF_000368145.1; RF=na; TAX=1217655; STAX=106649; NAME=Acinetobacter guillouiae CIP 63.46; strain=CIP 63.46; AL=Scaffold; RT=Major
Sequence
MIIPIRIGQGMDVHAFEEGDFVTLAGVQIPHTHGLKAHSDGDVVLHALCDALLGALALGD
IGQHFPDTDAEFKGADSRKLLKHVYQLILDRGYKLNNADITVACERPKLAKHNLEMRQSI
ADVLDVDVTQISVKATTTEKLGFTGRQEGILSTATVLISHLAK
Download sequence
Identical sequences A0A072D1C7 A0A0Q7G1Z5 E3NUC9 N8S384 N8WVU8
WP_004720660.1.15248 WP_004720660.1.19192 WP_004720660.1.22718 WP_004720660.1.25018 WP_004720660.1.53393 WP_004720660.1.55951 XP_003087993.1.11157 XP_005978367.1.78601 31234.CRE27997 CRE27997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]