SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004790864.1.93467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004790864.1.93467
Domain Number - Region: 36-143
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00628
Family Pseudo ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004790864.1.93467
Sequence length 171
Comment hypothetical protein [Borreliella garinii]; AA=GCF_000501655.1; RF=na; TAX=1408828; STAX=29519; NAME=Borrelia garinii IPT88; strain=IPT88; AL=Contig; RT=Major
Sequence
MKIQIISILLILLYLPLNARLLNISIEKRASEEIKKYSSFNLILEKEYYTNFPTSEIEKN
IYKLTEHFVKSIMLNKTDYSLLNSNYKEVNKYLIQSELIDNKFLKYKIFKIKNINGIFKS
YSLIYTKTGFYKLELYIENNVEPIKIFNLNITYFLKNSDKISNEMIFSPNE
Download sequence
Identical sequences B7XS64
WP_004790864.1.23943 WP_004790864.1.30439 WP_004790864.1.46387 WP_004790864.1.47313 WP_004790864.1.52841 WP_004790864.1.66686 WP_004790864.1.93467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]