SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004920344.1.21683 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004920344.1.21683
Domain Number 1 Region: 156-489
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-25
Family ABC transporter ATPase domain-like 0.09
Further Details:      
 
Weak hits

Sequence:  WP_004920344.1.21683
Domain Number - Region: 94-162
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0432
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004920344.1.21683
Sequence length 526
Comment DNA sulfur modification protein DndE [Riemerella anatipestifer]; AA=GCF_001670855.1; RF=na; TAX=34085; STAX=34085; NAME=Riemerella anatipestifer; strain=RCAD0134; AL=Contig; RT=Major
Sequence
MQINIRTSEANQEIVRKLTSKLPVGTKENVIARIALGYSLQNGKYFTSSEFNLYDSKGKE
YKDHILFDAKYRDFFIALICQHYGIYKTDDNIPKYIKLHIDHGLELMDNLFSNQHNYTFF
DFLTEHLDKGISFLDTVKVSLDAVKNNNQNIEKSYFGEPIKILVGNKLDEKTEDIVLNFN
DTNSYNNNHIAVAGSSGTGKTQFALQILKEISEKSNYHVNFIYLDFKGLKDDDLIQMQPF
FEKTRAQFIDAPNTPFPINPLSFIDSINDINKQMGIDKFVDIICKYSNIGIKQRGKLREA
TNEAFISKKPGEHPSFREINEQLLEIVGDKRDILTEIIEELSRYNVFQEDKKVKNFLNQN
IYLSLSGDLSNSVRFTSLFLIINYIYNVFMNMESTPTENGYRAMRYVLLIDEAHVIFKEK
KYQDILEKILREIRSKGVSVVLLSQGIEEFNQPTFDFSSMCEISFLLNVKDKNNTKAINK
FLGFSDKDGTKAYRSLEKIQKGQAISNIKEFSKGELFEIKQFYNTP
Download sequence
Identical sequences A0A162CIR3
WP_004920344.1.12819 WP_004920344.1.21683 WP_004920344.1.27570 WP_004920344.1.28646 WP_004920344.1.34653 WP_004920344.1.34861 WP_004920344.1.3884 WP_004920344.1.49580 WP_004920344.1.51207 WP_004920344.1.5278 WP_004920344.1.55645 WP_004920344.1.6213 WP_004920344.1.70085 WP_004920344.1.72231 WP_004920344.1.73884 WP_004920344.1.78695 WP_004920344.1.8112 WP_004920344.1.82490 WP_004920344.1.9884 gi|442314759|ref|YP_007356062.1| gi|386321964|ref|YP_006018126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]