SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005446954.1.30721 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005446954.1.30721
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.25e-26
Family Lipase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005446954.1.30721
Sequence length 275
Comment dienelactone hydrolase [Saccharomonospora azurea]; AA=GCF_000236985.1; RF=na; TAX=1114959; STAX=40988; NAME=Saccharomonospora azurea SZMC 14600; strain=SZMC 14600; AL=Contig; RT=Major
Sequence
MASTAKRLLEQLSHPGPHDVLRGDLALVGLPGVVFTPRSGLNLPAVTFGHGWLQAPGRYH
GLLRHLASWGIVAAAPATHRGVLPSHRLFAADLRTTLDLVTSLRLGPDGISVDPAKLGLA
GHSIGGGAAVLAAAPDDDTRRRVSAVATVGAAQTMPPATTAALRITAPGLHLAGEEDLLA
PATGNAEAISKAWAGPVQLRTIPKMTHLGVTEGTHWSQLLLQGKPQHTVQRRVRALFTAF
FLTELAGDDTYRELLDSDLKAARITYQDEASPAKV
Download sequence
Identical sequences H0K1W8
WP_005446954.1.30721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]