SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005575427.1.12069 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005575427.1.12069
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily CAC2185-like 1.7e-26
Family CAC2185-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005575427.1.12069
Sequence length 107
Comment bicyclomycin resistance protein [Aggregatibacter actinomycetemcomitans]; AA=GCF_001596225.1; RF=na; TAX=1434263; STAX=714; NAME=Aggregatibacter actinomycetemcomitans serotype e str. SA2149; strain=SA2149; AL=Contig; RT=Major
Sequence
MSLFSKIKRAVNKFHRKSINRELKNRLQNHGMSVLSSNCLGAFILHDLNEPFNLPFVNLY
VKPRNLIRYLQNMSHYHQQTLVFKSADKPYPVVLAAVCFKPVIEVLY
Download sequence
Identical sequences C9R3N0
WP_005575427.1.12069 WP_005575427.1.13356 WP_005575427.1.16246 WP_005575427.1.18228 gi|261867713|ref|YP_003255635.1| 668336.D11S_1029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]