SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005649159.1.37452 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005649159.1.37452
Domain Number - Region: 65-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0177
Family SMI1/KNR4-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005649159.1.37452
Sequence length 228
Comment MULTISPECIES: hypothetical protein [Haemophilus]; AA=GCF_900022495.1; RF=na; TAX=727; STAX=727; NAME=Haemophilus influenzae; strain=2842STDY5882085; AL=Scaffold; RT=Major
Sequence
MQTLEQLTSPEHSAWITLSQWIDNARNHCEVIKKDQSSAERELFTMQMPTSSPMGAVIYE
TGGILIHYGWLRILGSGSFKLPRGLMDWNFSKSFSESGEKPKYLLVADDVIGGYFALNGG
SLGNNIGKIYYYSSKDLTWHNLNFTYTEFLAWALNGDVEAFYQGLFWKNWQDDVKQLDGN
QVFVFTPDLNQDRKIAIDERQKQEVNIETHYQASFAEKNKFDLAYSVA
Download sequence
Identical sequences A0A0E1SPL6 A0A0X9ZQ86 A0A2J1DNP7 A4MXZ4 E1XA09 F2C2F4
gi|378696557|ref|YP_005178515.1| WP_005649159.1.13610 WP_005649159.1.17253 WP_005649159.1.20018 WP_005649159.1.34925 WP_005649159.1.37452 WP_005649159.1.40040 WP_005649159.1.40503 WP_005649159.1.42267 WP_005649159.1.51509 WP_005649159.1.57312 WP_005649159.1.75193 WP_005649159.1.76737 WP_005649159.1.78014 WP_005649159.1.81823 WP_005649159.1.82376 WP_005649159.1.85362 WP_005649159.1.86649 WP_005649159.1.87366 WP_005649159.1.88810 WP_005649159.1.93392 WP_005649159.1.93908 WP_005649159.1.9761 gi|386263429|ref|YP_005826922.1| gi|319775759|ref|YP_004138247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]