SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005690057.1.9147 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005690057.1.9147
Domain Number - Region: 44-67
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005690057.1.9147
Sequence length 126
Comment MULTISPECIES: hypothetical protein [Lactobacillus]; AA=GCF_001831275.1; RF=na; TAX=47715; STAX=47715; NAME=Lactobacillus rhamnosus; strain=ASCC 1521; AL=Scaffold; RT=Major
Sequence
MELDGKEIKENEQLTDAQLTELHQQYQALWDKLKKDNYKTDHQFMEVLYEEPDNIQNYEA
AFFTYQIRKDTGDNQFDQLNIILNNKPTFHDQPDEFVFEISDYSDMDAIYQAIEEKAQPW
IKAHKR
Download sequence
Identical sequences A0A0D6U9J0 A0A1F0RIF3 C2JT87 F3N0S5 K8Q5G7
WP_005690057.1.101361 WP_005690057.1.11050 WP_005690057.1.12139 WP_005690057.1.14021 WP_005690057.1.14188 WP_005690057.1.14284 WP_005690057.1.16044 WP_005690057.1.16842 WP_005690057.1.18223 WP_005690057.1.18871 WP_005690057.1.24248 WP_005690057.1.25484 WP_005690057.1.27841 WP_005690057.1.30532 WP_005690057.1.32073 WP_005690057.1.36928 WP_005690057.1.37924 WP_005690057.1.40906 WP_005690057.1.41093 WP_005690057.1.43381 WP_005690057.1.43697 WP_005690057.1.44898 WP_005690057.1.45310 WP_005690057.1.48411 WP_005690057.1.52120 WP_005690057.1.53572 WP_005690057.1.53665 WP_005690057.1.56295 WP_005690057.1.57122 WP_005690057.1.57153 WP_005690057.1.58801 WP_005690057.1.59185 WP_005690057.1.60726 WP_005690057.1.61450 WP_005690057.1.67031 WP_005690057.1.67264 WP_005690057.1.70097 WP_005690057.1.70401 WP_005690057.1.70502 WP_005690057.1.70613 WP_005690057.1.71250 WP_005690057.1.72024 WP_005690057.1.76218 WP_005690057.1.76540 WP_005690057.1.77423 WP_005690057.1.80670 WP_005690057.1.8089 WP_005690057.1.81670 WP_005690057.1.84719 WP_005690057.1.85245 WP_005690057.1.86216 WP_005690057.1.87473 WP_005690057.1.87509 WP_005690057.1.90835 WP_005690057.1.9147 WP_005690057.1.91665 WP_005690057.1.92011 WP_005690057.1.93242 WP_005690057.1.94635 WP_005690057.1.97125 WP_005690057.1.98686 WP_005690057.1.99535 gi|385834174|ref|YP_005871948.1| 568704.LC705_00232 gi|523515817|ref|YP_008201899.1| gi|258538423|ref|YP_003172922.1| gi|523518702|ref|YP_008204782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]