SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005723295.1.58111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005723295.1.58111
Domain Number - Region: 3-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000746
Family Glutathione S-transferase (GST), N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005723295.1.58111
Sequence length 87
Comment hypothetical protein [Pasteurella multocida]; AA=GCF_001578435.1; RF=na; TAX=1455592; STAX=747; NAME=Pasteurella multocida subsp. multocida PMTB2.1; strain=PMTB2.1; AL=Complete Genome; RT=Major
Sequence
MSKPVLFFANLCPDTAPFVAELARLEVDYESVEIMSSMANFKRFLTLRDQHPAFEQAKGN
GYIGIPALLWADEQVVLDIHQLKDIFG
Download sequence
Identical sequences Q9CLV3
272843.PM1099 WP_005723295.1.19996 WP_005723295.1.41351 WP_005723295.1.41667 WP_005723295.1.58111 WP_005723295.1.66990 WP_005723295.1.70689 WP_005723295.1.88402 WP_005723295.1.92478 WP_005723295.1.93940 WP_005723295.1.9947 gi|15602964|ref|NP_246036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]