SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005784912.1.37988 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005784912.1.37988
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00824
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005784912.1.37988
Sequence length 115
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_001997325.1; RF=na; TAX=817; STAX=817; NAME=Bacteroides fragilis; strain=ATCC 25285; AL=Scaffold; RT=Major
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A016CDB6 A0A0E2AFY9 A0A0E2S9I8 A0A0K6BRB7 Q5LHB0
gi|60680284|ref|YP_210428.1| WP_005784912.1.10083 WP_005784912.1.21107 WP_005784912.1.26934 WP_005784912.1.37988 WP_005784912.1.57121 WP_005784912.1.58084 WP_005784912.1.69826 WP_005784912.1.85293 WP_005784912.1.9461 272559.BF0728 396886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]