SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005786318.1.54019 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005786318.1.54019
Domain Number - Region: 53-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0018
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005786318.1.54019
Sequence length 115
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000598345.1; RF=na; TAX=1339312; STAX=817; NAME=Bacteroides fragilis str. 3783N2-1; strain=3783N2-1; AL=Contig; RT=Major
Sequence
MKQKKRPASQTEAMKLRWKKRIVFEKGYTEMCAEWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYDPTKIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A015ULR2 A0A015XJ19 A0A016EAQ7 A0A016F2U1 A0A017NDY1 A0A0E2AD67 A0A0E2ARM6 A0A0E2T7Z1 A0A0K6BSC4 E1WTB8 F7LNE5 I9BKL9 K1GL76
WP_005786318.1.10083 WP_005786318.1.101046 WP_005786318.1.11335 WP_005786318.1.21713 WP_005786318.1.26832 WP_005786318.1.31541 WP_005786318.1.34692 WP_005786318.1.35533 WP_005786318.1.35582 WP_005786318.1.36984 WP_005786318.1.40326 WP_005786318.1.43857 WP_005786318.1.44936 WP_005786318.1.48703 WP_005786318.1.49420 WP_005786318.1.50935 WP_005786318.1.51373 WP_005786318.1.5142 WP_005786318.1.51489 WP_005786318.1.52936 WP_005786318.1.53910 WP_005786318.1.54019 WP_005786318.1.57121 WP_005786318.1.60699 WP_005786318.1.60854 WP_005786318.1.63108 WP_005786318.1.63925 WP_005786318.1.66858 WP_005786318.1.66941 WP_005786318.1.69826 WP_005786318.1.73957 WP_005786318.1.78347 WP_005786318.1.81678 WP_005786318.1.85293 WP_005786318.1.87523 WP_005786318.1.88754 WP_005786318.1.89499 WP_005786318.1.89819 WP_005786318.1.93484 WP_005786318.1.93759 WP_005786318.1.9461 WP_005786318.1.94953 WP_005786318.1.95091 WP_005786318.1.95195 WP_005786318.1.98903 gi|375357844|ref|YP_005110616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]