SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005796181.1.88754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005796181.1.88754
Domain Number - Region: 62-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00902
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005796181.1.88754
Sequence length 115
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000599305.1; RF=na; TAX=1339330; STAX=817; NAME=Bacteroides fragilis str. S23L24; strain=S23L24; AL=Contig; RT=Major
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPAEVEGAVVYWNVDEQRWTTFQVENFMEWRPIA
Download sequence
Identical sequences A0A015ZWU6 A0A017NHY6 A0A0E2AU09 A0A0E2TH35
WP_005796181.1.10405 WP_005796181.1.11335 WP_005796181.1.39779 WP_005796181.1.43857 WP_005796181.1.7580 WP_005796181.1.81678 WP_005796181.1.87523 WP_005796181.1.88754 WP_005796181.1.89819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]