SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005812942.1.13927 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005812942.1.13927
Domain Number 1 Region: 320-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-31
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 212-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.4e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005812942.1.13927
Sequence length 524
Comment ribonuclease Y [Desulfitobacterium hafniense]; AA=GCF_000021925.1; RF=representative genome; TAX=272564; STAX=49338; NAME=Desulfitobacterium hafniense DCB-2; strain=DCB-2; AL=Complete Genome; RT=Major
Sequence
MCLGGENYLELTELIFIVVAVVVSLFVGGFIGWLIRKSAAEKLIGSAEEEAKRVIDNAQG
AAEAKRREAVIAAKEEVMHIRNEVEKESRERRNEIQRMERRVIQKEESLDRKMESLERKE
DNLHRKEEEVDQLKEVLTQTVAKEKQELERVSGLSTEEAKQILLQSVEEEVRYESAIMIK
DIETKAKEEAEKRAKNIISLAIQRCAADHVAESTVSVVALPSDEMKGRIIGREGRNIRTL
ETLTGIDLIIDDTPEAVILSGFDPIRREVARVALEKLIADGRIHPARIEEMVEKSQKEVD
QRIREEGEQATFETGVHGLHPEIIRLLGRLKFRTSYGQNVLKHSMEVSHLAGLMAAELGV
DVQLAKRAGLLHDLGKAVDHDTEGTHVQIGVDLAKKYKESWEVIHAIEAHHGDVEAKTIE
AVLVAAADAVSAARPGARRETLESYIKRLQKLEEIADTYDGVEKSYAIQAGREIRIIVRP
DKIDDVLAPKVAREISKRIEDELEYPGQIKVVVIRETRAVDYAK
Download sequence
Identical sequences A0A0W1JPG0 G9XPD5 Q24W62
gi|89894687|ref|YP_518174.1| WP_005812942.1.13927 WP_005812942.1.73069 WP_005812942.1.80252 WP_005812942.1.82035 WP_005812942.1.88067 WP_005812942.1.94859 138119.DSY1941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]