SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005817606.1.53995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005817606.1.53995
Domain Number - Region: 52-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00169
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005817606.1.53995
Sequence length 115
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000598285.1; RF=na; TAX=1339281; STAX=817; NAME=Bacteroides fragilis str. 2-F-2 #5; strain=2-F-2 #5; AL=Contig; RT=Major
Sequence
MKQKKRPASQTEAMKLRWKKRIVFEKGYTEQCAEWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYDPTQIEGAVVYWNVDEQRWTTFQMENFMEWRPIV
Download sequence
Identical sequences A0A015TJU8 A0A017N2A4 A0A0E2T4E0 A0A2J6AGW5 K1GKB9
WP_005817606.1.10040 WP_005817606.1.101046 WP_005817606.1.21713 WP_005817606.1.21908 WP_005817606.1.26832 WP_005817606.1.30158 WP_005817606.1.31541 WP_005817606.1.33107 WP_005817606.1.35818 WP_005817606.1.36984 WP_005817606.1.37052 WP_005817606.1.38746 WP_005817606.1.40326 WP_005817606.1.42362 WP_005817606.1.43857 WP_005817606.1.51373 WP_005817606.1.52936 WP_005817606.1.53885 WP_005817606.1.53910 WP_005817606.1.53995 WP_005817606.1.54019 WP_005817606.1.56204 WP_005817606.1.63925 WP_005817606.1.87523 WP_005817606.1.88754 WP_005817606.1.95091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]