SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006014606.1.82565 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006014606.1.82565
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-53
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 294-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-50
Family Ribonuclease PH domain 1-like 0.0000113
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.29e-30
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 452-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.15e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 622-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.22e-21
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006014606.1.82565
Sequence length 714
Comment polyribonucleotide nucleotidyltransferase [Brucella ovis]; AA=GCF_000367065.1; RF=na; TAX=1169231; STAX=236; NAME=Brucella ovis 80/125; strain=80/125; AL=Contig; RT=Major
Sequence
MFNTHKVEIEWGGRPLTIETGKIARQADGAVLATYGETAVLATVVSAKEPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFVDGYKNDTQVVITVLQH
DLENNPDILSMVAASAALTISGVPFMGPISGARVGYIDGEYVLNPNIDEMPESKLDLVVA
GTSEAVLMVESEAQELPEDVMLGAVMFGHKSFQPVIDAIIKLAEVAAKEPRDFQPEDLSE
LEAKVLAVVENDLREAYKITEKQARYAAVDAAKAKAKEHFFPEGVEETEMLAEQFATIFT
HLQAKIVRWNILDTGNRIDGRDLSTVRPIVSEVGILPRTHGSALFTRGETQAIVVATLGT
GEDEQMIDALTGTYKESFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPAA
EQFPYTIRAVSEITESNGSSSMATVCGTSLALMDAGVPIVRPVAGIAMGLIKEGERFAVL
SDILGDEDHLGDMDFKVAGTEFGITSLQMDIKIDGITEEIMKVALEQAKGGRVHILGEMA
KAISSSRAELGEFAPRIEVMNIPTDKIRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIA
SSNGKEIEAAKKWIHSIVAEPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADR
VAKTTDVVKEGQKVWVKLMGFDERGKVRLSMKVVDQETGKEIVAEKKKEEVDAE
Download sequence
Identical sequences A5VTB6 N8NA74
444178.BOV_2081 WP_006014606.1.101150 WP_006014606.1.14507 WP_006014606.1.20827 WP_006014606.1.33907 WP_006014606.1.47843 WP_006014606.1.48948 WP_006014606.1.49942 WP_006014606.1.53843 WP_006014606.1.56947 WP_006014606.1.78225 WP_006014606.1.82565 WP_006014606.1.84540 WP_006014606.1.87222 WP_006014606.1.9163 WP_006014606.1.94513 WP_006014606.1.94648 gi|148559480|ref|YP_001259963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]