SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006042515.1.60914 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006042515.1.60914
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000117
Family 7-Fe ferredoxin 0.0000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006042515.1.60914
Sequence length 81
Comment MULTISPECIES: photosystem I iron-sulfur center protein PsaC [Synechococcus]; AA=GCF_000063505.1; RF=na; TAX=32051; STAX=32051; NAME=Synechococcus sp. WH 7803; AL=Complete Genome; RT=Major
Sequence
MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGDETSRSMGLSY
Download sequence
Identical sequences A0A0R2U2G9 A4CTH7 A5GI59 G4FMY2 Q0IDV2
WP_006042515.1.44266 WP_006042515.1.57161 WP_006042515.1.60914 WP_006042515.1.65281 WP_006042515.1.66731 gi|148238534|ref|YP_001223921.1| 32051.SynWH7803_0198 64471.sync_0133 gi|113955567|ref|YP_729370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]