SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006101143.1.59225 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006101143.1.59225
Domain Number 1 Region: 8-213
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.75e-24
Family Haloperoxidase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006101143.1.59225
Sequence length 214
Comment hypothetical protein [Coleofasciculus chthonoplastes]; AA=GCF_000155555.1; RF=representative genome; TAX=118168; STAX=64178; NAME=Coleofasciculus chthonoplastes PCC 7420; strain=PCC 7420; AL=Scaffold; RT=Major
Sequence
MKIVLRYIYLHGLASNPGSAKAVYLRDRFAELGVSLFVPDLNQGDFSHLTLTRQIQQIQA
ECLSTPTPITLIGSSLGGLTAAWLGEYHTFIQRLVLLAPAFGFLWSWLSTLGEEALHQWQ
VEGYRPIYHYGEQKELPLSYKFVEDIRQYEQTHRLKRPIPTLILHGQHDEVIPINESLIY
AKERSWVQLIPFNSDHSLSDVKAEIWQSILAFCQ
Download sequence
Identical sequences B4VRJ7
WP_006101143.1.59225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]