SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006109355.1.25937 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006109355.1.25937
Domain Number 1 Region: 157-224
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000549
Family Carboxypeptidase regulatory domain 0.029
Further Details:      
 
Domain Number 2 Region: 251-326
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000000667
Family Cna protein B-type domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006109355.1.25937
Sequence length 332
Comment hypothetical protein [Natrialba asiatica]; AA=GCF_000337555.1; RF=representative genome; TAX=29540; STAX=64602; NAME=Natrialba asiatica DSM 12278; strain=DSM 12278; AL=Contig; RT=Major
Sequence
MSRNTRQQTADARSIQTGVQVLLTAAGVVLLVAGLALAASGASINETLGSIGDDDDSPDD
PGAGSNADDTDNGNATTDDGANGGDDTGDGNGGDDSGDGGGGDGNDTGNGNDDGNGSNGG
DDNGDGDGDNGDNNNGGNGSDDNDGDSGTSTQTLTTTVEDDNGNAISGASLELTGDSGTT
DVTTDNNGQAEFTVNDGEYTLTASADGYEESETDVEVDGSDESATLTLESEDGDDNGSDN
NSDDDSNTNTLTTTVEDSDNGSAIEGATVELYSGYQFFGPDADATTDDDGTAELDAESDE
YTGVVSADGYEETEFEVNLDEDQEVSIELESN
Download sequence
Identical sequences M0AU27
WP_006109355.1.25937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]