SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006248077.1.73782 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006248077.1.73782
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.96e-41
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006248077.1.73782
Sequence length 208
Comment protein disulfide-isomerase [Mannheimia haemolytica]; AA=GCF_000153645.1; RF=na; TAX=272629; STAX=75985; NAME=Mannheimia haemolytica PHL213; strain=PHL213; AL=Scaffold; RT=Major
Sequence
MKIEVWSDYACPFCYIGKRHLEQALAQFEGEVEVVFRAFELDPHANGEPEGDIQQRLMRK
YQKTAEQADEMIRYVEQAGKQAGLDLRYRTTQYTRTFEAHRLAKFAESKDLGEAMVERLF
KAYFTDNTILAKRTELISLALDIGLERDEIAQLLTGDDFGHEVREDERVAHKYGIHSVPF
FVINEKLGVSGAQPPEILLDAIKQALQK
Download sequence
Identical sequences A0A0B5BVG3 A0A248ZYD7 M9X7A7
gi|525701739|ref|YP_008233429.1| gi|526468992|ref|YP_008339206.1| WP_006248077.1.100578 WP_006248077.1.101281 WP_006248077.1.14651 WP_006248077.1.15850 WP_006248077.1.18032 WP_006248077.1.19836 WP_006248077.1.21690 WP_006248077.1.22107 WP_006248077.1.24300 WP_006248077.1.25136 WP_006248077.1.27302 WP_006248077.1.2785 WP_006248077.1.29735 WP_006248077.1.33793 WP_006248077.1.34159 WP_006248077.1.34894 WP_006248077.1.40079 WP_006248077.1.42410 WP_006248077.1.42606 WP_006248077.1.43708 WP_006248077.1.45083 WP_006248077.1.47009 WP_006248077.1.50719 WP_006248077.1.52776 WP_006248077.1.55804 WP_006248077.1.61638 WP_006248077.1.62250 WP_006248077.1.63192 WP_006248077.1.63974 WP_006248077.1.73398 WP_006248077.1.73782 WP_006248077.1.73864 WP_006248077.1.74727 WP_006248077.1.74925 WP_006248077.1.76946 WP_006248077.1.78880 WP_006248077.1.8019 WP_006248077.1.802 WP_006248077.1.81289 WP_006248077.1.82341 WP_006248077.1.84529 WP_006248077.1.90102 WP_006248077.1.91740 WP_006248077.1.93146 WP_006248077.1.94296 WP_006248077.1.95684 WP_006248077.1.95739 gi|482887022|ref|YP_007884195.1| gi|472333915|ref|YP_007666190.1| gi|525663066|ref|YP_008222004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]