SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006248542.1.62250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006248542.1.62250
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.34e-35
Family ArsC-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006248542.1.62250
Sequence length 115
Comment arsenate reductase [Mannheimia haemolytica]; AA=GCF_001930505.1; RF=na; TAX=75985; STAX=75985; NAME=Mannheimia haemolytica; strain=2612MH; AL=Scaffold; RT=Major
Sequence
MTTLVYGIKNCDTVKKALKWLEDHNQNPQLHDYRVDGLNADWLVEMEAKFGWENLVNKRS
TTWRNLDEEIKNNLNRESALKVLTEQPTLIKRPIVIKEDIALIGFNEKEYVAAFN
Download sequence
Identical sequences A0A0B5BSC6 A0A248ZWP2 M9WWK4 S9YE28
gi|525656772|ref|YP_008220189.1| gi|526469679|ref|YP_008339922.1| gi|525663718|ref|YP_008222696.1| gi|482884939|ref|YP_007882112.1| WP_006248542.1.100578 WP_006248542.1.101281 WP_006248542.1.14651 WP_006248542.1.15850 WP_006248542.1.18032 WP_006248542.1.19836 WP_006248542.1.20456 WP_006248542.1.2132 WP_006248542.1.21690 WP_006248542.1.22107 WP_006248542.1.23336 WP_006248542.1.24300 WP_006248542.1.25136 WP_006248542.1.26880 WP_006248542.1.27302 WP_006248542.1.2785 WP_006248542.1.28573 WP_006248542.1.29735 WP_006248542.1.30596 WP_006248542.1.33793 WP_006248542.1.34159 WP_006248542.1.34894 WP_006248542.1.39283 WP_006248542.1.40079 WP_006248542.1.41844 WP_006248542.1.42410 WP_006248542.1.42606 WP_006248542.1.43708 WP_006248542.1.44810 WP_006248542.1.45083 WP_006248542.1.47009 WP_006248542.1.49314 WP_006248542.1.49495 WP_006248542.1.50719 WP_006248542.1.52776 WP_006248542.1.55804 WP_006248542.1.61638 WP_006248542.1.62250 WP_006248542.1.63192 WP_006248542.1.63974 WP_006248542.1.72771 WP_006248542.1.73398 WP_006248542.1.73782 WP_006248542.1.73864 WP_006248542.1.74727 WP_006248542.1.74925 WP_006248542.1.76946 WP_006248542.1.78880 WP_006248542.1.8019 WP_006248542.1.802 WP_006248542.1.81289 WP_006248542.1.82341 WP_006248542.1.84529 WP_006248542.1.8479 WP_006248542.1.90102 WP_006248542.1.91740 WP_006248542.1.93146 WP_006248542.1.94296 WP_006248542.1.95684 WP_006248542.1.95739 WP_006248542.1.9701 gi|525702402|ref|YP_008234134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]