SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006249144.1.9701 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006249144.1.9701
Domain Number - Region: 45-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0112
Family Glutathione peroxidase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006249144.1.9701
Sequence length 185
Comment hypothetical protein [Mannheimia haemolytica]; AA=GCF_000176275.1; RF=na; TAX=669262; STAX=75985; NAME=Mannheimia haemolytica serotype A2 str. BOVINE; strain=BOVINE; AL=Contig; RT=Major
Sequence
MKKLFAQAVIFGAFFASSAFAHNVQLNQALPAVSVAKDGELAVAGGKVSYKNWHSSSLAG
KVRVIHHFAGRSSVKEKNEDLMTAIKNAGFDRSKYQTVTIVNADDAIVGTGVFVKNSVEN
GKLDNPHSQVVLDQQGSVKKAWGLKEKESFIAVLDKSGKVQFTSEGKLSAKQIQEVIGLV
KTLTQ
Download sequence
Identical sequences A0A0B5BLH1 A0A249A1T5 E2P4K0 M9WX80 S9YGZ5
gi|525664663|ref|YP_008223678.1| WP_006249144.1.100578 WP_006249144.1.101281 WP_006249144.1.14651 WP_006249144.1.15850 WP_006249144.1.18032 WP_006249144.1.19836 WP_006249144.1.20456 WP_006249144.1.2132 WP_006249144.1.21690 WP_006249144.1.22107 WP_006249144.1.23336 WP_006249144.1.24300 WP_006249144.1.25136 WP_006249144.1.26880 WP_006249144.1.27302 WP_006249144.1.2785 WP_006249144.1.28573 WP_006249144.1.29735 WP_006249144.1.30596 WP_006249144.1.33793 WP_006249144.1.34159 WP_006249144.1.34894 WP_006249144.1.39283 WP_006249144.1.40079 WP_006249144.1.41844 WP_006249144.1.42410 WP_006249144.1.42606 WP_006249144.1.43708 WP_006249144.1.44810 WP_006249144.1.45083 WP_006249144.1.47009 WP_006249144.1.49314 WP_006249144.1.49495 WP_006249144.1.50719 WP_006249144.1.52776 WP_006249144.1.55804 WP_006249144.1.61638 WP_006249144.1.62250 WP_006249144.1.63192 WP_006249144.1.63974 WP_006249144.1.72771 WP_006249144.1.73398 WP_006249144.1.73782 WP_006249144.1.73864 WP_006249144.1.74727 WP_006249144.1.74925 WP_006249144.1.76946 WP_006249144.1.78880 WP_006249144.1.8019 WP_006249144.1.802 WP_006249144.1.81289 WP_006249144.1.82341 WP_006249144.1.84529 WP_006249144.1.8479 WP_006249144.1.90102 WP_006249144.1.91740 WP_006249144.1.93146 WP_006249144.1.94296 WP_006249144.1.95684 WP_006249144.1.95739 WP_006249144.1.9701 gi|482885950|ref|YP_007883123.1| gi|472335955|ref|YP_007668229.1| gi|525703360|ref|YP_008235142.1| gi|472334549|ref|YP_007666824.1| gi|526468102|ref|YP_008338221.1| gi|525657620|ref|YP_008221059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]