SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006249532.1.14651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006249532.1.14651
Domain Number 1 Region: 50-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000156
Family Thioltransferase 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006249532.1.14651
Sequence length 165
Comment thiol-disulfide isomerase [Mannheimia haemolytica]; AA=GCF_000341635.1; RF=na; TAX=1261125; STAX=75985; NAME=Mannheimia haemolytica serotype 6 str. H23; strain=H23; AL=Contig; RT=Major
Sequence
MAHFYEYLEFNSDEDRENQLEVYVEVKLSTDTEEKLQAVGVQGDWLVMAEPYCPDCVEIV
AYFQRMAKLNPNIKVKYVARKDNQERKHFDSDEQQQAVISAQKIPTIFDIRNGKTELVLS
EFPQFLKDKMAANPEQFEQLKADFRMGKFGKEVEAELLAILLNTK
Download sequence
Identical sequences A0A0B5BXA5 A0A249A3S4 E2P848 M9X020
gi|526467781|ref|YP_008337881.1| gi|525664358|ref|YP_008223366.1| gi|525657337|ref|YP_008220773.1| gi|525703043|ref|YP_008234805.1| gi|482885608|ref|YP_007882781.1| WP_006249532.1.100578 WP_006249532.1.101281 WP_006249532.1.14651 WP_006249532.1.15850 WP_006249532.1.18032 WP_006249532.1.19836 WP_006249532.1.20456 WP_006249532.1.2132 WP_006249532.1.21690 WP_006249532.1.22107 WP_006249532.1.23336 WP_006249532.1.24300 WP_006249532.1.25136 WP_006249532.1.26880 WP_006249532.1.27302 WP_006249532.1.2785 WP_006249532.1.28573 WP_006249532.1.29735 WP_006249532.1.30596 WP_006249532.1.33793 WP_006249532.1.34159 WP_006249532.1.34894 WP_006249532.1.40079 WP_006249532.1.41844 WP_006249532.1.42410 WP_006249532.1.42606 WP_006249532.1.43708 WP_006249532.1.44810 WP_006249532.1.45083 WP_006249532.1.47009 WP_006249532.1.49314 WP_006249532.1.49495 WP_006249532.1.50719 WP_006249532.1.52776 WP_006249532.1.55804 WP_006249532.1.61638 WP_006249532.1.62250 WP_006249532.1.63192 WP_006249532.1.63974 WP_006249532.1.72771 WP_006249532.1.73398 WP_006249532.1.73782 WP_006249532.1.73864 WP_006249532.1.74727 WP_006249532.1.74925 WP_006249532.1.76946 WP_006249532.1.78880 WP_006249532.1.8019 WP_006249532.1.802 WP_006249532.1.81289 WP_006249532.1.82341 WP_006249532.1.84529 WP_006249532.1.8479 WP_006249532.1.90102 WP_006249532.1.91740 WP_006249532.1.93146 WP_006249532.1.94296 WP_006249532.1.95684 WP_006249532.1.95739 WP_006249532.1.9701 gi|472335659|ref|YP_007667933.1| gi|472334896|ref|YP_007667171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]