SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006249972.1.33793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006249972.1.33793
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000127
Family Thioltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006249972.1.33793
Sequence length 86
Comment hypothetical protein [Mannheimia haemolytica]; AA=GCF_001596735.1; RF=na; TAX=75985; STAX=75985; NAME=Mannheimia haemolytica; strain=3927A; AL=Contig; RT=Major
Sequence
MKPILYFADWCPDTAPFVAELDRLGIEYEPCDITKGGSTLKPFLKLRDTHSAFDHAKANG
YIGIPALLIEGEKVVLDLAELEGIFG
Download sequence
Identical sequences A0A0B5BZC5 A0A249A313 E2P584 M9X2V6
gi|525657135|ref|YP_008220560.1| gi|482885367|ref|YP_007882540.1| gi|472335419|ref|YP_007667693.1| gi|525702550|ref|YP_008234292.1| gi|472335136|ref|YP_007667411.1| gi|526467557|ref|YP_008337644.1| WP_006249972.1.100578 WP_006249972.1.101281 WP_006249972.1.14651 WP_006249972.1.15850 WP_006249972.1.18032 WP_006249972.1.19836 WP_006249972.1.20456 WP_006249972.1.2132 WP_006249972.1.21690 WP_006249972.1.22107 WP_006249972.1.23336 WP_006249972.1.24300 WP_006249972.1.25136 WP_006249972.1.26880 WP_006249972.1.27302 WP_006249972.1.2785 WP_006249972.1.28573 WP_006249972.1.29735 WP_006249972.1.30596 WP_006249972.1.33793 WP_006249972.1.34159 WP_006249972.1.34894 WP_006249972.1.40079 WP_006249972.1.41844 WP_006249972.1.42410 WP_006249972.1.42606 WP_006249972.1.43708 WP_006249972.1.44810 WP_006249972.1.45083 WP_006249972.1.47009 WP_006249972.1.49495 WP_006249972.1.50719 WP_006249972.1.52776 WP_006249972.1.55804 WP_006249972.1.61638 WP_006249972.1.62250 WP_006249972.1.63192 WP_006249972.1.63974 WP_006249972.1.72771 WP_006249972.1.73398 WP_006249972.1.73782 WP_006249972.1.73864 WP_006249972.1.74727 WP_006249972.1.74925 WP_006249972.1.76946 WP_006249972.1.78880 WP_006249972.1.8019 WP_006249972.1.802 WP_006249972.1.81289 WP_006249972.1.82341 WP_006249972.1.84529 WP_006249972.1.8479 WP_006249972.1.90102 WP_006249972.1.91740 WP_006249972.1.93146 WP_006249972.1.94296 WP_006249972.1.95684 WP_006249972.1.95739 WP_006249972.1.9701 gi|525664093|ref|YP_008223081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]