SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006250045.1.52776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006250045.1.52776
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-38
Family Thioltransferase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006250045.1.52776
Sequence length 109
Comment thiol reductase thioredoxin [Mannheimia haemolytica]; AA=GCF_000443225.1; RF=na; TAX=1329902; STAX=75985; NAME=Mannheimia haemolytica MhBrain2012; strain=MhBrain2012; AL=Contig; RT=Major
Sequence
MSNVIHTTDATFEQDVLKSDVPVLLDFWAPWCGPCRMIGPVLDDLSVDAQFDGKVKIVKM
NVDENPSVPAQFGVRSIPFLLLFKNGEVIAQQVGAIPHAQMAEFIKQAL
Download sequence
Identical sequences A0A0B5BX30 A0A248ZXZ1 E2P8U5 M9X8Y7 S9ZMW0
gi|482887206|ref|YP_007884379.1| gi|525663219|ref|YP_008222180.1| gi|526469168|ref|YP_008339394.1| gi|525656223|ref|YP_008219605.1| gi|472336972|ref|YP_007669246.1| WP_006250045.1.100578 WP_006250045.1.101281 WP_006250045.1.14651 WP_006250045.1.15850 WP_006250045.1.18032 WP_006250045.1.19836 WP_006250045.1.20456 WP_006250045.1.2132 WP_006250045.1.21690 WP_006250045.1.22107 WP_006250045.1.23336 WP_006250045.1.24300 WP_006250045.1.25136 WP_006250045.1.26880 WP_006250045.1.27302 WP_006250045.1.2785 WP_006250045.1.28573 WP_006250045.1.29735 WP_006250045.1.30596 WP_006250045.1.33793 WP_006250045.1.34159 WP_006250045.1.34894 WP_006250045.1.39283 WP_006250045.1.40079 WP_006250045.1.41844 WP_006250045.1.42410 WP_006250045.1.42606 WP_006250045.1.43708 WP_006250045.1.44810 WP_006250045.1.45083 WP_006250045.1.47009 WP_006250045.1.49314 WP_006250045.1.49495 WP_006250045.1.50719 WP_006250045.1.52776 WP_006250045.1.55804 WP_006250045.1.61638 WP_006250045.1.62250 WP_006250045.1.63192 WP_006250045.1.63974 WP_006250045.1.72771 WP_006250045.1.73398 WP_006250045.1.73782 WP_006250045.1.73864 WP_006250045.1.74727 WP_006250045.1.74925 WP_006250045.1.76946 WP_006250045.1.78880 WP_006250045.1.8019 WP_006250045.1.802 WP_006250045.1.81289 WP_006250045.1.82341 WP_006250045.1.84529 WP_006250045.1.8479 WP_006250045.1.90102 WP_006250045.1.91740 WP_006250045.1.93146 WP_006250045.1.94296 WP_006250045.1.95684 WP_006250045.1.95739 WP_006250045.1.9701 gi|525701901|ref|YP_008233616.1| gi|472333381|ref|YP_007665656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]