SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006250338.1.49314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006250338.1.49314
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-42
Family Glutathione peroxidase-like 0.000000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006250338.1.49314
Sequence length 165
Comment 2-Cys peroxiredoxin [Mannheimia haemolytica]; AA=GCF_000176255.1; RF=na; TAX=669261; STAX=75985; NAME=Mannheimia haemolytica serotype A2 str. OVINE; strain=OVINE; AL=Contig; RT=Major
Sequence
MSKVTLAGSPIDVAGTFPQKGDVVADFTLVNSDLSDVSLSDFDGKRKVLNIFPSIDTGIC
ATSVRVFNQKAADVANTVVLCISADLPFAQARFCGAEGIENAKVLSSFRHRDLHNKLGVD
IISGPLAGLTSRSVIVLDENNKVLHSELVPEIKQEPDYEAALAVL
Download sequence
Identical sequences A0A0B5BKB4 E2P5H9 M9X2Y0 Q06PY7 S9Y1V4
gi|472337660|ref|YP_007669934.1| gi|482885076|ref|YP_007882249.1| gi|525702818|ref|YP_008234568.1| gi|526469809|ref|YP_008340054.1| gi|525663826|ref|YP_008222806.1| gi|472332698|ref|YP_007664973.1| gi|525656859|ref|YP_008220278.1| WP_006250338.1.100578 WP_006250338.1.101281 WP_006250338.1.14651 WP_006250338.1.15850 WP_006250338.1.18032 WP_006250338.1.19836 WP_006250338.1.20456 WP_006250338.1.2132 WP_006250338.1.21690 WP_006250338.1.22107 WP_006250338.1.23336 WP_006250338.1.24300 WP_006250338.1.25136 WP_006250338.1.26880 WP_006250338.1.27302 WP_006250338.1.2785 WP_006250338.1.28573 WP_006250338.1.29735 WP_006250338.1.30596 WP_006250338.1.33793 WP_006250338.1.34159 WP_006250338.1.34894 WP_006250338.1.39283 WP_006250338.1.41844 WP_006250338.1.42410 WP_006250338.1.42606 WP_006250338.1.43708 WP_006250338.1.44810 WP_006250338.1.45083 WP_006250338.1.47009 WP_006250338.1.49314 WP_006250338.1.49495 WP_006250338.1.50719 WP_006250338.1.52776 WP_006250338.1.55804 WP_006250338.1.61638 WP_006250338.1.62250 WP_006250338.1.63192 WP_006250338.1.63974 WP_006250338.1.72771 WP_006250338.1.73398 WP_006250338.1.73782 WP_006250338.1.73864 WP_006250338.1.74727 WP_006250338.1.74925 WP_006250338.1.76946 WP_006250338.1.78880 WP_006250338.1.8019 WP_006250338.1.802 WP_006250338.1.81289 WP_006250338.1.82341 WP_006250338.1.84529 WP_006250338.1.8479 WP_006250338.1.90102 WP_006250338.1.91740 WP_006250338.1.93146 WP_006250338.1.94296 WP_006250338.1.95684 WP_006250338.1.95739 WP_006250338.1.9701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]