SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006250428.1.23336 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006250428.1.23336
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 7e-19
Family Thioltransferase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006250428.1.23336
Sequence length 87
Comment glutaredoxin, GrxA family [Mannheimia haemolytica]; AA=GCF_001930855.1; RF=na; TAX=75985; STAX=75985; NAME=Mannheimia haemolytica; strain=327518MH; AL=Scaffold; RT=Major
Sequence
MFVEIYGRLSCPYCVRAKTLAEKMKQELSDFDFKFIDMIAENISKQDLEPRVGKPVATVP
QIFVDNNHVGGCTDFQAFVEEKFGITV
Download sequence
Identical sequences A0A0B5BQM9 A0A249A268 M9WZZ0 S9ZIM4
WP_006250428.1.100578 WP_006250428.1.101281 WP_006250428.1.14651 WP_006250428.1.15850 WP_006250428.1.18032 WP_006250428.1.19836 WP_006250428.1.20456 WP_006250428.1.2132 WP_006250428.1.21690 WP_006250428.1.22107 WP_006250428.1.23336 WP_006250428.1.24300 WP_006250428.1.25136 WP_006250428.1.26880 WP_006250428.1.27302 WP_006250428.1.2785 WP_006250428.1.28573 WP_006250428.1.29735 WP_006250428.1.30596 WP_006250428.1.33793 WP_006250428.1.34159 WP_006250428.1.34894 WP_006250428.1.39283 WP_006250428.1.40079 WP_006250428.1.41844 WP_006250428.1.42410 WP_006250428.1.42606 WP_006250428.1.43708 WP_006250428.1.44810 WP_006250428.1.45083 WP_006250428.1.47009 WP_006250428.1.49314 WP_006250428.1.49495 WP_006250428.1.50719 WP_006250428.1.52776 WP_006250428.1.55804 WP_006250428.1.61638 WP_006250428.1.62250 WP_006250428.1.63192 WP_006250428.1.63974 WP_006250428.1.72771 WP_006250428.1.73398 WP_006250428.1.73782 WP_006250428.1.73864 WP_006250428.1.74727 WP_006250428.1.74925 WP_006250428.1.76946 WP_006250428.1.78880 WP_006250428.1.8019 WP_006250428.1.802 WP_006250428.1.81289 WP_006250428.1.82341 WP_006250428.1.84529 WP_006250428.1.8479 WP_006250428.1.90102 WP_006250428.1.91740 WP_006250428.1.93146 WP_006250428.1.94296 WP_006250428.1.95684 WP_006250428.1.95739 WP_006250428.1.9701 gi|472335634|ref|YP_007667908.1| gi|526467758|ref|YP_008337858.1| gi|525703022|ref|YP_008234784.1| gi|482885583|ref|YP_007882756.1| gi|472334921|ref|YP_007667196.1| gi|525657315|ref|YP_008220751.1| gi|525664337|ref|YP_008223345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]