SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006250446.1.802 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006250446.1.802
Domain Number 1 Region: 7-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-43
Family Glutathione peroxidase-like 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006250446.1.802
Sequence length 244
Comment glutathione amide-dependent peroxidase [Mannheimia haemolytica]; AA=GCF_001596565.1; RF=na; TAX=75985; STAX=75985; NAME=Mannheimia haemolytica; strain=L02A; AL=Contig; RT=Major
Sequence
MSFKDMTGQKVPSVTFRTRQNDAWVDVTTDELFNNKTVVVFSLPGAFTPTCSSTHLPRYN
ELACEFKALGVDDIICMSVNDTFVMNAWKADQESENITVIPDGNGEFTEGMGLLVDKNDL
GFGKRSWRYSMLVKNGIVEKMFIEPQEPGDPFKVSDADTMIKYLSPNWTAKESVSIITKP
GCLFCAKAKALLKEQGYTFEEIVLGRDASTISVRAITGKTSVPQVFIGGKYIGGSDELAA
YFAK
Download sequence
Identical sequences A0A249A3W4 M9X498
WP_006250446.1.100578 WP_006250446.1.101281 WP_006250446.1.14651 WP_006250446.1.15850 WP_006250446.1.18032 WP_006250446.1.19836 WP_006250446.1.21690 WP_006250446.1.22107 WP_006250446.1.24300 WP_006250446.1.25136 WP_006250446.1.2785 WP_006250446.1.28573 WP_006250446.1.29735 WP_006250446.1.33793 WP_006250446.1.34159 WP_006250446.1.34894 WP_006250446.1.42410 WP_006250446.1.42606 WP_006250446.1.43708 WP_006250446.1.45083 WP_006250446.1.47009 WP_006250446.1.50719 WP_006250446.1.52776 WP_006250446.1.55804 WP_006250446.1.61638 WP_006250446.1.62250 WP_006250446.1.63192 WP_006250446.1.63974 WP_006250446.1.73398 WP_006250446.1.73782 WP_006250446.1.73864 WP_006250446.1.74727 WP_006250446.1.74925 WP_006250446.1.76946 WP_006250446.1.78880 WP_006250446.1.8019 WP_006250446.1.802 WP_006250446.1.81289 WP_006250446.1.82341 WP_006250446.1.84529 WP_006250446.1.90102 WP_006250446.1.91740 WP_006250446.1.93146 WP_006250446.1.94296 WP_006250446.1.95684 WP_006250446.1.95739 gi|525703004|ref|YP_008234766.1| gi|526467740|ref|YP_008337840.1| gi|472335617|ref|YP_007667891.1| gi|482885566|ref|YP_007882739.1| gi|472334938|ref|YP_007667213.1| gi|525664319|ref|YP_008223327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]