SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006256926.1.93699 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006256926.1.93699
Domain Number 1 Region: 47-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000523
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006256926.1.93699
Sequence length 155
Comment MULTISPECIES: SMI1/KNR4 family protein [Myroides]; AA=GCF_001485415.1; RF=na; TAX=76832; STAX=76832; NAME=Myroides odoratimimus; strain=CCUG39352; AL=Contig; RT=Major
Sequence
MKFPKAITDFIAKEIECTHYFMPQFYPQQGDIEGFQDGYKYNSVEGKDITGTKEGDFHPN
WYVICGGYAQDPYWIDITKEEKGFPVYFAEHGAGKWEPLLVADSLGEFEECVKYMIYLTE
SELSKEEIERLYNERFDLDSPFWELVWSEFSFDEE
Download sequence
Identical sequences A0A0E1ZAY1 A0A0S7EEI6
WP_006256926.1.24692 WP_006256926.1.46351 WP_006256926.1.65817 WP_006256926.1.93699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]