SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006451399.1.11469 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006451399.1.11469
Domain Number 1 Region: 2-310
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.32e-65
Family Proline iminopeptidase-like 0.0000000000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006451399.1.11469
Sequence length 313
Comment prolyl aminopeptidase [Xanthomonas gardneri]; AA=GCF_001908775.1; RF=representative genome; TAX=90270; STAX=90270; NAME=Xanthomonas gardneri; strain=ICMP7383; AL=Complete Genome; RT=Major
Sequence
MRMLYPEITPYDHGTLQVDDRHTLYFEQCGNPQGKPVVMLHGGPGGGCNTKMRRFHDPAK
YRIVLFDQRGAGRSTPHADLVDNTTWDLVADIERLREHLGIARWQVFGGSWGSTLALAYA
QTHPQQVTELVLRGIFLLRRFELEWFYQQGASRLFPDAWEHYINAIPPVERADLMSAFHR
RLTSDDEATRLAAAKAWSVWEGATSFLHVDEDFVTGHEDAHFALAFARIENHYFVNGGFF
EVEDQLLRDAHRIADIPGVIVHGRYDVVCPLQSAWDLHKVWPKSTLQVSPASGHSGFEPE
NVDALVRATDGFA
Download sequence
Identical sequences A0A0G8L5J6 A0A248YG83 F0C856
WP_006451399.1.11469 WP_006451399.1.14073 WP_006451399.1.16695 WP_006451399.1.22679 WP_006451399.1.24731 WP_006451399.1.38766 WP_006451399.1.39297 WP_006451399.1.56692 WP_006451399.1.71095 WP_006451399.1.8677 WP_006451399.1.91306 WP_006451399.1.93028 WP_006451399.1.93448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]