SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006485353.1.29408 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006485353.1.29408
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.1e-50
Family STM4215-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006485353.1.29408
Sequence length 154
Comment MULTISPECIES: hypothetical protein [Burkholderia cepacia complex]; AA=GCF_001993035.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC7925; AL=Contig; RT=Major
Sequence
MATTLEMVDAIVARLRVKLPALVTEYFPERPDEYRLNHAIGALLVSYPGSQYDTTVDTDM
VVQPRRVKFAVAIVLRQLNGRGGAIDVLDHVRTALVGFRPPDCKKLAAVSDKFLGESAGL
WQYVIEFSAGAVIVEDAEPNDGPLLTQVTYEEES
Download sequence
Identical sequences A0A1V2XF31 B4ENR6 Q6QIB2
216591.BCAS0520 Q6QIB2_9CAUD gi|48696947|ref|YP_024710.1| gi|197295363|ref|YP_002153904.1| WP_006485353.1.10003 WP_006485353.1.100706 WP_006485353.1.101897 WP_006485353.1.10541 WP_006485353.1.11355 WP_006485353.1.14088 WP_006485353.1.21852 WP_006485353.1.22015 WP_006485353.1.25261 WP_006485353.1.27304 WP_006485353.1.27889 WP_006485353.1.27910 WP_006485353.1.29408 WP_006485353.1.31157 WP_006485353.1.31547 WP_006485353.1.33877 WP_006485353.1.34650 WP_006485353.1.38687 WP_006485353.1.40288 WP_006485353.1.45869 WP_006485353.1.52424 WP_006485353.1.52705 WP_006485353.1.55547 WP_006485353.1.57568 WP_006485353.1.60885 WP_006485353.1.64618 WP_006485353.1.66306 WP_006485353.1.67642 WP_006485353.1.69134 WP_006485353.1.70783 WP_006485353.1.71578 WP_006485353.1.71688 WP_006485353.1.72171 WP_006485353.1.7270 WP_006485353.1.75651 WP_006485353.1.79353 WP_006485353.1.82360 WP_006485353.1.83528 WP_006485353.1.85579 WP_006485353.1.86231 WP_006485353.1.87780 WP_006485353.1.87798 WP_006485353.1.88782 WP_006485353.1.95357 WP_006485353.1.95626 WP_006485353.1.95790 WP_006485353.1.98001 WP_006485353.1.99008 YP_024710.1.36390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]