SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006688605.1.21584 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006688605.1.21584
Domain Number 1 Region: 3-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 7.72e-51
Family Obg GTP-binding protein N-terminal domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 161-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.49e-49
Family G proteins 0.0000575
Further Details:      
 
Domain Number 3 Region: 363-435
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 2.75e-17
Family Obg GTP-binding protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006688605.1.21584
Sequence length 435
Comment GTPase ObgE [Ureaplasma parvum]; AA=GCF_000171375.1; RF=na; TAX=515608; STAX=134821; NAME=Ureaplasma parvum serovar 1 str. ATCC 27813; strain=ATCC 27813; AL=Contig; RT=Major
Sequence
MAFIDKCKIVLIAGNGGDGIVSWRRETHVPEGGPAGGNGGNGGSIWFVGNHNETSLEFLK
YKKIIRAKHGEKGDIKNQHGANAEDVFINVPLGTVVYNPITNEILADINIDQQKYLVAQG
GLGGHGNTHFKSPFNKAPNLYELGELGENVEVLLELKTIADIGIIGLPNAGKSTLISTFT
NAKPKTANYMFTTLNPVLGTIYRDQNRIIFADIPGLIEGAHTGVGLGHDFLKHIERCFLL
IHLISLDPNDNPDIINAYETIVNELKQYKQNLVNKPIVLVANKIDQIGALENLQILKEYL
KNNQEIKIISALTNLHVDNMLDDVIKIYFAQKKIYEQRLKEQLPVDQILKWTSDIPKSKE
LDKTIEIIKVDDHIFEVFGEYLKYWAHRIPLKTQDNLIRFNQKLQSINFNQQLLQAGAVA
GDSIKIYDITLEFEE
Download sequence
Identical sequences B1AJA2 Q9PQ29
gi|13358024|ref|NP_078298.1| 273119.UU461 505682.UPA3_0480 WP_006688605.1.13444 WP_006688605.1.15075 WP_006688605.1.21584 WP_006688605.1.25107 WP_006688605.1.48879 WP_006688605.1.72504 WP_006688605.1.74768 gi|170761902|ref|YP_001752546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]