SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006827626.1.63456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006827626.1.63456
Domain Number 1 Region: 160-226
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000239
Family Carboxypeptidase regulatory domain 0.023
Further Details:      
 
Domain Number 2 Region: 254-330
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000051
Family Cna protein B-type domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006827626.1.63456
Sequence length 335
Comment hypothetical protein [Natrialba taiwanensis]; AA=GCF_000337595.1; RF=na; TAX=1230458; STAX=160846; NAME=Natrialba taiwanensis DSM 12281; strain=DSM 12281; AL=Contig; RT=Major
Sequence
MSRNTRQQTADARSIQTGVQILLTAAGVVLLVAGLALAASGASINETLGSIGDDDDSPDD
QDAGSNADDTDNGNATDDGANGGDDTDDGNGGDDSGDGGGDDGNDTGNGNDDGNGANGGD
DNGDGDGAGDGNNGDNNNGGNGNDDNDGDSGTSTQTLTTTVEDDNGNAISGATLELTGDS
GTTDVTTDNNGQAEFTVNDGEYTLTASADGYEESETDVEVDGSDESATLTLESEDDDDNG
SDNDSDDDSNTNTLTTTVEDSSNGSAIEGATVELYSGYQFFGPDADATTDDDGSAELDAE
SDEYTVVVSADGYEETEFEVNLDEDQDVSIELDSN
Download sequence
Identical sequences L9ZH51
WP_006827626.1.63456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]