SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007386503.1.56061 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007386503.1.56061
Domain Number 1 Region: 168-371
Classification Level Classification E-value
Superfamily Lysozyme-like 5.06e-68
Family Family 19 glycosidase 0.00000764
Further Details:      
 
Domain Number 2 Region: 36-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.04e-40
Family Ricin B-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007386503.1.56061
Sequence length 371
Comment endochitinase [Streptomyces sviceus]; AA=GCF_000154965.1; RF=na; TAX=463191; STAX=285530; NAME=Streptomyces sviceus ATCC 29083; strain=ATCC 29083; AL=Chromosome; RT=Major
Sequence
MSLSLRRGRLAVFAVLAAVLTALLTVTPAHAASGTITGLAGKCVDVAGASTANGTAVQLY
DCNGTGAQIWSNPGDGTLRALGKCLDIADRGTADGAAVQLWDCSGGANQQWVVSGARDIV
NPAANKCLDVRDNNSANGTRLQIWTCSGTANQKWNAPASGGGSTPSGFVVTEAQFNQMFP
NRNSFYTYSGLVAALSAYPGFATTGSDTVRKQEAAAFLANVNHETGGLVYVVEQNTANYP
TYCDWNQPYGCPAGQAAYYGRGPIQLSWNFNYKAAGDALGIDLLNNPWLVQNDSAVAWKT
GLWYWNTQSGPGTMTPHNAMVNQAGFGQTIRSINGSLECDGRNPAQVQSRVDAYNRFTSI
LGVAPGGNLYC
Download sequence
Identical sequences B5HZA0
WP_007386503.1.56061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]