SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007472129.1.46104 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007472129.1.46104
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-16
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_007472129.1.46104
Sequence length 239
Comment SMI1/KNR4 family protein [Listeria fleischmannii]; AA=GCF_001050295.1; RF=na; TAX=1430899; STAX=1069827; NAME=Listeria fleischmannii 1991; strain=1991; AL=Scaffold; RT=Major
Sequence
MWLITESKKATEEQIEQFETQNKVRLPASYRALLKEQNGGFIKKNHLKTSEPTSYGINFL
EIYQIFGIDKLITEPQAALENPLSGHYIYFSKDGARYIGFDYRTEEPSIFYADFETLQTL
TIASDFDSFQNQLYFEPFEIHQAPSYGQAKLDQMLIQADFKTRVEILALLEDEAEKTWYL
TQLKKLILAKKEELAYPLFENQILYFRRKLPEVLVLELFELLKASDINLTALQREWKGE
Download sequence
Identical sequences A0A0J8GCW9
WP_007472129.1.46104 WP_007472129.1.94356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]