SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007641509.1.41521 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007641509.1.41521
Domain Number 1 Region: 32-105
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000000942
Family Coronavirus S2 glycoprotein 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007641509.1.41521
Sequence length 215
Comment ATPase involved in DNA repair [Paraglaciecola psychrophila]; AA=GCF_000347635.1; RF=representative genome; TAX=1129794; STAX=326544; NAME=Paraglaciecola psychrophila 170; strain=170; AL=Complete Genome; RT=Major
Sequence
MLIMKKLIFVSLIIFLAGCQSAYYAAWEKVGVEKRDILVDRVEDAKESQEDAQKQFSSAL
DEFSQIVSYNGGELQDVYNQLKNQFEASEQSAASVTSRIDKVESVAEALFDEWEEELEKY
TNNNLKRESQNRLRDTQRRYKSLVSSMKKAESKMEPVLSALRDNVLYLKHNLNASAIGAL
QGEFNGIKKEINQLVLEMNKAISESNSFISSMKSK
Download sequence
Identical sequences K7AW83
WP_007641509.1.30881 WP_007641509.1.41521 gi|476416664|ref|YP_007546582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]