SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007848421.1.36284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007848421.1.36284
Domain Number - Region: 76-95
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00667
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007848421.1.36284
Sequence length 111
Comment MULTISPECIES: hypothetical protein [Bacteroides]; AA=GCF_000273035.1; RF=na; TAX=997875; STAX=357276; NAME=Bacteroides dorei CL02T00C15; strain=CL02T00C15; AL=Scaffold; RT=Major
Sequence
MNDIPPDSLALTGEQKNDVRRMASLGYAPEDIAAYLGLDASECFLFVYDAGIPGTTIRGL
IREGVLVSRAAPEIKLHEAAEDGNIDAVKLLTEIQERRLFENLLKDMDEYE
Download sequence
Identical sequences A0A174L0D6 C6ZB08 I8WC77
WP_007848421.1.36284 WP_007848421.1.54640 WP_007848421.1.8648 WP_007848421.1.97168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]