SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008285131.1.102007 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008285131.1.102007
Domain Number 1 Region: 22-312
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.1e-59
Family Aclacinomycin methylesterase RdmC 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008285131.1.102007
Sequence length 330
Comment hydrolase, alpha/beta fold family [gamma proteobacterium HTCC5015]; AA=GCF_000155715.1; RF=na; TAX=391615; STAX=391615; NAME=gamma proteobacterium HTCC5015; strain=HTCC5015; AL=Scaffold; RT=Major
Sequence
MNSETSTEMMRAPHTAIQCRTGYVQANGQSLYYEDWGRESDPAIVMVMGLAAQLIVWPTE
LVRSLAAQGYRVIRFDNRDIGWSSETVDCEPRHLARNWLKYRLGRPVEAPYTLYDMVEDS
IGLMDVLGIQKAHWVGASMGGMIAQLAASLHPHRALSLTTIMSSTNERYLQWPALSVLRG
LLRGRGPIHSAEQAGEALLAFWQHIKSPALPADPQSVYRRAMAAYQRSFRPKAPLRHTLA
VMATGGFAHLLNRVRVPALVIHGSVDPLIRLDGGQDSARHLPNARLKVVDGMGHELPEAL
IDDFAAWIGDHVSATTAPNKEAPWPQGRAA
Download sequence
Identical sequences B5JWT0
WP_008285131.1.102007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]