SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008573624.1.40690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008573624.1.40690
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.17e-31
Family Thioltransferase 0.00053
Further Details:      
 
Domain Number 2 Region: 201-302
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.01e-21
Family Single-domain sulfurtransferase 0.0091
Further Details:      
 
Domain Number 3 Region: 114-201
Classification Level Classification E-value
Superfamily HesB-like domain 0.000000000049
Family HesB-like domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008573624.1.40690
Sequence length 308
Comment MULTISPECIES: monothiol glutaredoxin, Grx4 family [Xanthomonas]; AA=GCF_000802325.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=66b; AL=Contig; RT=Major
Sequence
MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQE
IREGIKAYGDWPTIPQLYVDGELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPA
AVEMLKSALADAPDASLTLAIDANFQPNFQLAPTNPNAIAAESNGLRVQFDLASARRADG
ITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALATVAA
PFRTLDAHERAAIEQLPKDTPLAFLCHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDE
VDNGVAKY
Download sequence
Identical sequences A0A0G9CP12 A0A1S1XK37 G2LTE8 Q3BPF6
gi|78049182|ref|YP_365357.1| 316273.XCV3626 WP_008573624.1.100156 WP_008573624.1.100312 WP_008573624.1.10442 WP_008573624.1.11230 WP_008573624.1.12827 WP_008573624.1.13735 WP_008573624.1.14159 WP_008573624.1.16263 WP_008573624.1.17112 WP_008573624.1.19776 WP_008573624.1.199 WP_008573624.1.20169 WP_008573624.1.21303 WP_008573624.1.2230 WP_008573624.1.2259 WP_008573624.1.23534 WP_008573624.1.24172 WP_008573624.1.25231 WP_008573624.1.27112 WP_008573624.1.29361 WP_008573624.1.3003 WP_008573624.1.30677 WP_008573624.1.3440 WP_008573624.1.37569 WP_008573624.1.37942 WP_008573624.1.39371 WP_008573624.1.40690 WP_008573624.1.43396 WP_008573624.1.43419 WP_008573624.1.44794 WP_008573624.1.46449 WP_008573624.1.46677 WP_008573624.1.47244 WP_008573624.1.47958 WP_008573624.1.48351 WP_008573624.1.49886 WP_008573624.1.51091 WP_008573624.1.5224 WP_008573624.1.54158 WP_008573624.1.54709 WP_008573624.1.55770 WP_008573624.1.56262 WP_008573624.1.57452 WP_008573624.1.59767 WP_008573624.1.60785 WP_008573624.1.61221 WP_008573624.1.64411 WP_008573624.1.656 WP_008573624.1.66420 WP_008573624.1.67180 WP_008573624.1.67877 WP_008573624.1.6838 WP_008573624.1.68402 WP_008573624.1.72305 WP_008573624.1.75734 WP_008573624.1.772 WP_008573624.1.77810 WP_008573624.1.78066 WP_008573624.1.79359 WP_008573624.1.79878 WP_008573624.1.80975 WP_008573624.1.81489 WP_008573624.1.85024 WP_008573624.1.85152 WP_008573624.1.8544 WP_008573624.1.86099 WP_008573624.1.89212 WP_008573624.1.89360 WP_008573624.1.94781 WP_008573624.1.94946 WP_008573624.1.96073 WP_008573624.1.9928 WP_008573624.1.99285 gi|346726272|ref|YP_004852941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]