SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008574748.1.61221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008574748.1.61221
Domain Number 1 Region: 14-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.19e-44
Family Glutathione peroxidase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008574748.1.61221
Sequence length 160
Comment MULTISPECIES: peroxiredoxin [Xanthomonas]; AA=GCF_001009385.1; RF=na; TAX=442694; STAX=442694; NAME=Xanthomonas perforans; strain=Xp7-12; AL=Contig; RT=Major
Sequence
MTDAVLELPAATFDLPLALSGGTHTTLRDHAGTWLVLYFYPKDSTPGCTTEGLDFNALLP
QFKKAGAMVLGVSRDSVKSHDNFCAKQGFAFPLISDSDEALCRAFDVIKEKNMYGKQVLG
IERSTFLLSPEGHVVQEWRKVKVAGHAEAVLAAVKAHAKQ
Download sequence
Identical sequences A0A0G8V986 A0A1S1XGG5 G2LQG5 Q3BUP4
316273.XCV1788 gi|346724685|ref|YP_004851354.1| gi|78047344|ref|YP_363519.1| WP_008574748.1.100156 WP_008574748.1.100312 WP_008574748.1.10442 WP_008574748.1.11230 WP_008574748.1.12827 WP_008574748.1.14159 WP_008574748.1.16263 WP_008574748.1.17112 WP_008574748.1.19776 WP_008574748.1.199 WP_008574748.1.20169 WP_008574748.1.21303 WP_008574748.1.21317 WP_008574748.1.2230 WP_008574748.1.2259 WP_008574748.1.23534 WP_008574748.1.24172 WP_008574748.1.25231 WP_008574748.1.3003 WP_008574748.1.30677 WP_008574748.1.331 WP_008574748.1.3440 WP_008574748.1.37569 WP_008574748.1.37942 WP_008574748.1.39371 WP_008574748.1.40690 WP_008574748.1.43396 WP_008574748.1.43419 WP_008574748.1.44794 WP_008574748.1.46449 WP_008574748.1.46677 WP_008574748.1.47244 WP_008574748.1.47958 WP_008574748.1.48351 WP_008574748.1.49886 WP_008574748.1.50405 WP_008574748.1.51091 WP_008574748.1.5224 WP_008574748.1.54158 WP_008574748.1.54709 WP_008574748.1.55770 WP_008574748.1.56262 WP_008574748.1.57452 WP_008574748.1.59767 WP_008574748.1.60785 WP_008574748.1.61221 WP_008574748.1.64411 WP_008574748.1.656 WP_008574748.1.66420 WP_008574748.1.67180 WP_008574748.1.67877 WP_008574748.1.6838 WP_008574748.1.68402 WP_008574748.1.72305 WP_008574748.1.75734 WP_008574748.1.772 WP_008574748.1.78066 WP_008574748.1.79359 WP_008574748.1.79878 WP_008574748.1.80975 WP_008574748.1.81489 WP_008574748.1.85024 WP_008574748.1.85152 WP_008574748.1.8544 WP_008574748.1.86099 WP_008574748.1.89212 WP_008574748.1.89360 WP_008574748.1.94781 WP_008574748.1.94946 WP_008574748.1.96073 WP_008574748.1.9928 WP_008574748.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]